PDB entry 1q7b

View 1q7b on RCSB PDB site
Description: The structure of betaketoacyl-[ACP] reductase from E. coli in complex with NADP+
Class: oxidoreductase
Keywords: oxoacyl reductase; NADP+; crystal structure, OXIDOREDUCTASE
Deposited on 2003-08-17, released 2004-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q7ba_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q7bb_
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q7bc_
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q7bd_
  • Heterogens: CA, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q7bA (A:)
    mnfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnv
    tdpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlska
    vmrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvva
    pgfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvngg
    mymv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7bA (A:)
    nfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnvt
    dpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlskav
    mrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvvap
    gfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvnggm
    ymv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q7bB (B:)
    mnfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnv
    tdpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlska
    vmrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvva
    pgfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvngg
    mymv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7bB (B:)
    nfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnvt
    dpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlskav
    mrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvvap
    gfietdmtrsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvnggmym
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q7bC (C:)
    mnfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnv
    tdpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlska
    vmrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvva
    pgfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvngg
    mymv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7bC (C:)
    nfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnvt
    dpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlskav
    mrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvvap
    gfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvnggm
    ymv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q7bD (D:)
    mnfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnv
    tdpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlska
    vmrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvva
    pgfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvngg
    mymv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7bD (D:)
    nfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnvt
    dpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlskav
    mrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvvap
    gfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvnggm
    ymv