PDB entry 1q79

View 1q79 on RCSB PDB site
Description: crystal structure of mammalian poly(a) polymerase
Deposited on 2003-08-16, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.205
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q79A (A:)
    mpfpvttqgsqqtqppqkhygitspislaapketdalltqklvetlkpfgvfeeeeelqr
    rililgklnnlvkewireisesknlpqsvienvggkiftfgsyrlgvhtkgadidalcva
    prhvdrsdfftsfydklklqeevkdlraveeafvpviklcfdgieidilfarlalqtipe
    dldlrddsllknldirairslngcrvtdeilhlvpnidnfrltlraiklwakrhniysni
    lgflggvswamlvartcqlypnaiastlvhkfflvfskwewpnpvllkqpeecnlnlpvw
    dprvnpsdryhlmpiitpaypqqnstynvsvstrmvmveefkqglaitdeillskaewsk
    lfeapnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqs
    fpapkenpdkeefrtmwviglvfkktensenlsvdltydiqsftdtvyrqainskmfevd
    mkiaamhvkrkqlhqllpshvlqkkkkhstegvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q79A (A:)
    hygitspislaapketdalltqklvetlkpfgvfeeeeelqrrililgklnnlvkewire
    isesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklk
    lqeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldirai
    rslngcrvtdeilhlvpnidnfrltlraiklwakrhniysnilgflggvswamlvartcq
    lypnaiastlvhkfflvfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitp
    aypqqnstynvsvstrmvmveefkqglaitdeillskaewsklfeapnffqkykhyivll
    asaptekqrlewvglveskirilvgsleknefitlahvnpqsfpapkenpdkeefrtmwv
    iglvfkdltydiqsftdtvyrqainskmfevdmkiaamhvkrkqlhqllp