PDB entry 1q78

View 1q78 on RCSB PDB site
Description: Crystal structure of poly(A) polymerase in complex with 3'-dATP and magnesium chloride
Deposited on 2003-08-16, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q78A (A:)
    mpfpvttqgsqqtqppqkhygitspislaapketdalltqklvetlkpfgvfeeeeelqr
    rililgklnnlvkewireisesknlpqsvienvggkiftfgsyrlgvhtkgadidalcva
    prhvdrsdfftsfydklklqeevkdlraveeafvpviklcfdgieidilfarlalqtipe
    dldlrddsllknldirairslngcrvtdeilhlvpnidnfrltlraiklwakrhniysni
    lgflggvswamlvartcqlypnaiastlvhkfflvfskwewpnpvllkqpeecnlnlpvw
    dprvnpsdryhlmpiitpaypqqnstynvsvstrmvmveefkqglaitdeillskaewsk
    lfeapnffqkykhyivllasaptekqrlewvglveskirilvgsleknefitlahvnpqs
    fpapkenpdkeefrtmwviglvfkktensenlsvdltydiqsftdtvyrqainskmfevd
    mkiaamhvkrkqlhqllpshvlqkkkkhstegvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q78A (A:)
    hygitspislaapketdalltqklvetlkpfgvfeeeeelqrrililgklnnlvkewire
    isesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklk
    lqeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldirai
    rslngcrvtdeilhlvpnidnfrltlraiklwakrhniysnilgflggvswamlvartcq
    lypnaiastlvhkfflvfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitp
    aypqqnstynvsvstrmvmveefkqglaitdeillskaewsklfeapnffqkykhyivll
    asaptekqrlewvglveskirilvgsleknefitlahvnpqsfpapkenpdkeefrtmwv
    iglvfkdltydiqsftdtvyrqainskmfevdmkiaamhvkrkqlhqllp