PDB entry 1q77

View 1q77 on RCSB PDB site
Description: X-ray crystal structure of putative Universal Stress Protein from Aquifex aeolicus
Class: Structural genomics, unknown function
Keywords: Structural genomics, universal stress protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2003-08-16, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AQ_178
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: aq_178
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66565 (3-137)
      • cloning artifact (0-2)
      • modified residue (3)
    Domains in SCOPe 2.08: d1q77a1, d1q77a2
  • Chain 'B':
    Compound: Hypothetical protein AQ_178
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: aq_178
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66565 (3-137)
      • cloning artifact (0-2)
      • modified residue (3)
    Domains in SCOPe 2.08: d1q77b1, d1q77b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q77A (A:)
    snamkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfpp
    eikeeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacyps
    aylckvidglnlaslivk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q77B (B:)
    snamkvllvltdaysdcekaityavnfseklgaeldilavledvynleranvtfglpfpp
    eikeeskkrierrlrevwekltgsteipgveyrigplseevkkfvegkgyelvvwacyps
    aylckvidglnlaslivk