PDB entry 1q72

View 1q72 on RCSB PDB site
Description: Anti-Cocaine Antibody M82G2 Complexed with Cocaine
Class: immune system
Keywords: anti-cocaine antibody, fab
Deposited on 2003-08-15, released 2003-08-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-19, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.218
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab M82G2, Heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1q72h1, d1q72h2
  • Chain 'L':
    Compound: Fab M82G2, Light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1q72l1, d1q72l2
  • Heterogens: COC, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q72H (H:)
    evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
    kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
    aasttppsvyplapgsggastsgsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavl
    ngdlytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q72H (H:)
    evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
    kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
    aasttppsvyplapgsggagsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlngd
    lytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q72L (L:)
    divmtqaapsvpvtpgesvsiscrssksllhsngytylhwflqrpgqspqlliyrvsnla
    sgvpdrfsgsgsgtaftlrfsrveaedvgvyycmqhleypftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypqditvswkidgaerssgvlnswtdqdssdstysm
    sstltltkdeyerhssytceathktstspitksfnrge