PDB entry 1q6u

View 1q6u on RCSB PDB site
Description: Crystal structure of FkpA from Escherichia coli
Class: isomerase
Keywords: chaperone, peptidyl-prolyl isomerase, heat shock protein, FKBP family, ISOMERASE
Deposited on 2003-08-14, released 2004-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.214
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
    Species: Escherichia coli [TaxId:562]
    Gene: FKPA OR B3347
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q6ua_
  • Heterogens: CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q6uA (A:)
    aeaakpataadskaafknddqksayalgaslgrymenslkeqeklgikldkdqliagvqd
    afadksklsdqeieqtlqafearvkssaqakmekdaadneakgkeyrekfakekgvktss
    tglvyqvveagkgeapkdsdtvvvnykgtlidgkefdnsytrgeplsfrldgvipgwteg
    lknikkggkiklvippelaygkagvpgippnstlvfdvelldvkpapkadakpeadakaa
    dsakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6uA (A:)
    afknddqksayalgaslgrymenslkeqeklgikldkdqliagvqdafadksklsdqeie
    qtlqafearvkssaqakmekdaadneakgkeyrekfakekgvktsstglvyqvveagkge
    apkdsdtvvvnykgtlidgkefdnsytrgeplsfrldgvipgwteglknikkggkiklvi
    ppelaygkagvpgippnstlvfdvelldvkpap