PDB entry 1q6r

View 1q6r on RCSB PDB site
Description: Structure of 3-keto-L-gulonate 6-phosphate decarboxylase with bound L-xylulose 5-phosphate
Class: lyase
Keywords: beta barrel, lyase
Deposited on 2003-08-13, released 2003-10-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.192
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q6ra_
  • Chain 'B':
    Compound: 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q6rb_
  • Heterogens: MG, LX1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q6rA (A:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtwe
    qaqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6rA (A:)
    slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
    dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
    aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
    gipihvfiagrsirdaaspveaarqfkrsiaelw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q6rB (B:)
    mslpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivl
    adakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtwe
    qaqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplf
    kgipihvfiagrsirdaaspveaarqfkrsiaelwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6rB (B:)
    slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
    dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
    aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
    gipihvfiagrsirdaaspveaarqfkrsiaelwg