PDB entry 1q6h

View 1q6h on RCSB PDB site
Description: Crystal structure of a truncated form of FkpA from Escherichia coli
Class: isomerase
Keywords: chaperone, peptidyl-prolyl isomerase, heat shock protein, FKBP family, ISOMERASE
Deposited on 2003-08-13, released 2004-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.184
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
    Species: Escherichia coli [TaxId:562]
    Gene: FKPA OR B3347
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45523 (Start-223)
      • modified residue (34)
      • modified residue (91)
    Domains in SCOPe 2.08: d1q6ha_
  • Chain 'B':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase fkpA
    Species: Escherichia coli [TaxId:562]
    Gene: FKPA OR B3347
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45523 (Start-223)
      • modified residue (34)
      • modified residue (91)
    Domains in SCOPe 2.08: d1q6hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q6hA (A:)
    aeaakpataadskaafknddqksayalgaslgrymenslkeqeklgikldkdqliagvqd
    afadksklsdqeieqtlqafearvkssaqakmekdaadneakgkeyrekfakekgvktss
    tglvyqvveagkgeapkdsdtvvvnykgtlidgkefdnsytrgeplsfrldgvipgwteg
    lknikkggkiklvippelaygkagvpgippnstlvfdvelldvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6hA (A:)
    afknddqksayalgaslgrymenslkeqeklgikldkdqliagvqdafadksklsdqeie
    qtlqafearvkssaqakmekdaadneakgkeyrekfakekgvktsstglvyqvveagkge
    apkdsdtvvvnykgtlidgkefdnsytrgeplsfrldgvipgwteglknikkggkiklvi
    ppelaygkagvpgippnstlvfdvelldvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q6hB (B:)
    aeaakpataadskaafknddqksayalgaslgrymenslkeqeklgikldkdqliagvqd
    afadksklsdqeieqtlqafearvkssaqakmekdaadneakgkeyrekfakekgvktss
    tglvyqvveagkgeapkdsdtvvvnykgtlidgkefdnsytrgeplsfrldgvipgwteg
    lknikkggkiklvippelaygkagvpgippnstlvfdvelldvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6hB (B:)
    afknddqksayalgaslgrymenslkeqeklgikldkdqliagvqdafadksklsdqeie
    qtlqafearvkssaqakmekdaadneakgkeyrekfakekgvktsstglvyqvveagkge
    apkdsdtvvvnykgtlidgkefdnsytrgeplsfrldgvipgwteglknikkggkiklvi
    ppelaygkagvpgippnstlvfdvelldvk