PDB entry 1q6a

View 1q6a on RCSB PDB site
Description: Solution Structure of the C-terminal Domain of Thermosynechococcus elongatus KaiA (ThKaiA180C); Averaged Minimized Structure
Class: Circadian Clock Protein
Keywords: All alpha-helix protein, Homodimer, Circadian Clock Protein
Deposited on 2003-08-13, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Circadian clock protein KaiA homolog
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: KaiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RR35
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1q6aa1, d1q6aa2
  • Chain 'B':
    Compound: Circadian clock protein KaiA homolog
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: KaiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RR35 (3-106)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1q6ab1, d1q6ab2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q6aA (A:)
    amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
    velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q6aB (B:)
    amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
    velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev