PDB entry 1q67

View 1q67 on RCSB PDB site
Description: Crystal structure of Dcp1p
Class: transcription
Keywords: beta sandwich
Deposited on 2003-08-12, released 2004-03-02
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Decapping protein involved in mRNA degradation-Dcp1p
    Species: Saccharomyces cerevisiae
    Gene: DCP1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1q67a_
  • Chain 'B':
    Compound: Decapping protein involved in mRNA degradation-Dcp1p
    Species: Saccharomyces cerevisiae
    Gene: DCP1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1q67b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q67A (A:)
    mtgaataaensatqlefyrkalnfnvigrydpkikqllfhtphaslykwdfkkdewnkle
    yqgvlaiylrdvsqntnllpvspqevdifdsqngsnniqvnngsdnsnrnssgngnsyks
    ndsltyncgktlsgkdiynygliilnrinpdnfsmgivpnsvvnkrkvfnaeedtlnple
    cmgvevkdelviiknlkhevygiwihtvsdrqniyelikyllenepkdsfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q67A (A:)
    lnfnvigrydpkikqllfhtphaslykwdfkkdewnkleyqgvlaiylrdvskdiynygl
    iilnrinpdnfsmgivpnsvvnkrkvfnaeedtlnplecmgvevkdelviiknlkhevyg
    iwihtvsdrqniyelikyllenepkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q67B (B:)
    mtgaataaensatqlefyrkalnfnvigrydpkikqllfhtphaslykwdfkkdewnkle
    yqgvlaiylrdvsqntnllpvspqevdifdsqngsnniqvnngsdnsnrnssgngnsyks
    ndsltyncgktlsgkdiynygliilnrinpdnfsmgivpnsvvnkrkvfnaeedtlnple
    cmgvevkdelviiknlkhevygiwihtvsdrqniyelikyllenepkdsfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q67B (B:)
    fyrkalnfnvigrydpkikqllfhtphaslykwdfkkdewnkleyqgvlaiylrdvsqnt
    nllpkdiynygliilnrinpdnfsmgivpnsvvnkrkvfnaeedtlnplecmgvevkdel
    viiknlkhevygiwihtvsdrqniyelikyllenepkdsfa