PDB entry 1q62

View 1q62 on RCSB PDB site
Description: PKA double mutant model of PKB
Class: Transferase/Transferase Inhibitor
Keywords: Q181 switch, PKB-Model, Transferase/Transferase Inhibitor COMPLEX
Deposited on 2003-08-12, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: -1.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (Start-349)
      • engineered (122)
      • engineered (172)
      • modified residue (196)
      • modified residue (337)
    Domains in SCOPe 2.07: d1q62a_
  • Chain 'I':
    Compound: cAMP-dependent protein kinase inhibitor, alpha form
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q62A (A:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyapggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q62A (A:)
    esvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamk
    ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyapggemfshl
    rrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyiqvtdfgfakrvk
    grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
    gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
    pfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    No sequence available.