PDB entry 1q5z

View 1q5z on RCSB PDB site
Description: Crystal Structure of the C-terminal Actin Binding Domain of Salmonella Invasion Protein A (SipA)
Deposited on 2003-08-11, released 2003-10-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q5za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5zA (A:)
    gpvdkagttdndnsqtdktgpfsglkfkqnsflstvpsvtnmhsmhfdaretflgvirka
    lepdtstpfpvrrafdglraeilpndtiksaalkaqcsdidkhpelkakmetlkevithh
    pqkeklaeialqfareagltrlkgetdyvlsnvldgligdgswragpayesylnkpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5zA (A:)
    pfsglkfkqnsflstvpsvtnmhsmhfdaretflgvirkalepdtstpfpvrrafdglra
    eilpndtiksaalkaqcsdidkhpelkakmetlkevithhpqkeklaeialqfareaglt
    rlkgetdyvlsnvldgligdgswra