PDB entry 1q5x

View 1q5x on RCSB PDB site
Description: structure of of rraa (meng), a protein inhibitor of rna processing
Deposited on 2003-08-11, released 2003-09-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-30, with a file datestamp of 2003-09-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q5xa_
  • Chain 'B':
    Domains in SCOP 1.67: d1q5xb_
  • Chain 'C':
    Domains in SCOP 1.67: d1q5xc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5xA (A:)
    mkydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrv
    lvvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaa
    gegigesdvrvnfggvtffsgdhlyadntgiilsedpldie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5xA (A:)
    kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
    vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
    egigesdvrvnfggvtffsgdhlyadntgiilsedpldie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q5xB (B:)
    mkydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrv
    lvvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaa
    gegigesdvrvnfggvtffsgdhlyadntgiilsedpldie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5xB (B:)
    kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
    vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
    egigesdvrvnfggvtffsgdhlyadntgiilsedpld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q5xC (C:)
    mkydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrv
    lvvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaa
    gegigesdvrvnfggvtffsgdhlyadntgiilsedpldie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5xC (C:)
    kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
    vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
    egigesdvrvnfggvtffsgdhlyadntgiilsed