PDB entry 1q5u

View 1q5u on RCSB PDB site
Description: human dutp pyrophosphatase
Deposited on 2003-08-11, released 2003-08-19
The last revision prior to the SCOP 1.71 freeze date was dated 2003-08-19, with a file datestamp of 2003-08-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.71: d1q5ux_
  • Chain 'Y':
    Domains in SCOP 1.71: d1q5uy_
  • Chain 'Z':
    Domains in SCOP 1.71: d1q5uz_

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1q5uX (X:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5uX (X:)
    hhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcyg
    rvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifyp
    eieevqalddt
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1q5uY (Y:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5uY (Y:)
    hmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrv
    aprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypei
    eevqald
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1q5uZ (Z:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5uZ (Z:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqald