PDB entry 1q5q

View 1q5q on RCSB PDB site
Description: The Rhodococcus 20S proteasome
Class: hydrolase
Keywords: proteasome assembly, pro-peptide, inter-subunit contacts, Rhodococcus erythropolis, HYDROLASE
Deposited on 2003-08-08, released 2003-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.246
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qa_
  • Chain 'B':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qb_
  • Chain 'C':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qc_
  • Chain 'D':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qd_
  • Chain 'E':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qe_
  • Chain 'F':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qf_
  • Chain 'G':
    Compound: proteasome alpha-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCA(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qg_
  • Chain 'H':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qh_
  • Chain 'I':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qi_
  • Chain 'J':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qj_
  • Chain 'K':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qk_
  • Chain 'L':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5ql_
  • Chain 'M':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qm_
  • Chain 'N':
    Compound: proteasome beta-type subunit 1
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: PRCB(1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5qn_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5qA (A:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qA (A:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q5qB (B:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qB (B:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q5qC (C:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qC (C:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q5qD (D:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qD (D:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1q5qE (E:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qE (E:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1q5qF (F:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qF (F:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1q5qG (G:)
    mtmpyyasaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
    gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
    eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
    vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
    esapepkpdtetkpadtqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qG (G:)
    aeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrlgfaavgky
    nefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyeveicvaevg
    rvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaavgiavnal
    rqggvdvaslevavldqsrprrafrriagtaleqlvpae
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q5qH (H:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteqggsarhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qH (H:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1q5qI (I:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteqggsarhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qI (I:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1q5qJ (J:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteqggsarhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qJ (J:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1q5qK (K:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteqggsarhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qK (K:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1q5qL (L:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteqggsarhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qL (L:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1q5qM (M:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteqggsarhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qM (M:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1q5qN (N:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteqggsarhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5qN (N:)
    ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
    velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
    vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
    tggpdltrgiyptavtitqagavhvseettselarrivaerteq