PDB entry 1q5p

View 1q5p on RCSB PDB site
Description: S156E/S166D variant of Bacillus lentus subtilisin
Class: hydrolase
Keywords: serine protease, subtilisin, site-specific variant, altered flexibility, hydrolase
Deposited on 2003-08-08, released 2003-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.169
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease
    Species: Bacillus lentus [TaxId:1467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q5pa_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q5pA (A:)
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaaldnsigvlgvapsaelyavkvlgasgsgaissiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnegagsidyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr