PDB entry 1q5m

View 1q5m on RCSB PDB site
Description: Binary complex of rabbit 20alpha-hydroxysteroid dehydrogenase with NADPH
Class: oxidoreductase
Keywords: NADPH, HSD, hydroxysteroid dehydrogenase, aldo-keto reductase, OXIDOREDUCTASE
Deposited on 2003-08-08, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin-E2 9-reductase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5ma_
  • Chain 'B':
    Compound: Prostaglandin-E2 9-reductase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5mb_
  • Heterogens: SO4, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q5mA (A:)
    dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
    glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
    lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
    lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpli
    galakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnr
    nfryvtadfaighpnypfsdey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q5mB (B:)
    dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
    glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
    lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
    lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpli
    galakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnr
    nfryvtadfaighpnypfsdey