PDB entry 1q5l

View 1q5l on RCSB PDB site
Description: NMR structure of the substrate binding domain of DnaK bound to the peptide NRLLLTG
Deposited on 2003-08-08, released 2003-11-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q5la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5lA (A:)
    mgsshhhhhhglvprgshmvdvtplslgietmggvmttliaknttiptkhsqvfstaedn
    qsavtihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdkn
    sgkeqkitikassgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5lA (A:)
    dvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkraadnk
    slgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgl