PDB entry 1q5l

View 1q5l on RCSB PDB site
Description: NMR structure of the substrate binding domain of DnaK bound to the peptide NRLLLTG
Class: chaperone
Keywords: Hsp70, chaperone, heat shock protein
Deposited on 2003-08-08, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein dnaK
    Species: Escherichia coli [TaxId:562]
    Gene: DNAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5la_
  • Chain 'B':
    Compound: peptide NRLLLTG
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Q5L (0-6)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5lA (A:)
    mgsshhhhhhglvprgshmvdvtplslgietmggvmttliaknttiptkhsqvfstaedn
    qsavtihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdkn
    sgkeqkitikassgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5lA (A:)
    dvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkraadnk
    slgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgl
    

  • Chain 'B':
    No sequence available.