PDB entry 1q5h

View 1q5h on RCSB PDB site
Description: Human dUTP Pyrophosphatase complex with dUDP
Class: hydrolase
Keywords: DNA repair, enzyme-DNA interactions
Deposited on 2003-08-07, released 2003-08-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dUTP pyrophosphatase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1q5ha_
  • Chain 'B':
    Compound: dUTP pyrophosphatase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1q5hb_
  • Chain 'C':
    Compound: dUTP pyrophosphatase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33316 (6-End)
      • his tag (0-5)
    Domains in SCOP 1.73: d1q5hc_
  • Heterogens: MG, DUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5hA (A:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5hA (A:)
    mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
    prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
    evqaldd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q5hB (B:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5hB (B:)
    mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
    prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
    evqalddtergsggfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q5hC (C:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5hC (C:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfg