PDB entry 1q5h

View 1q5h on RCSB PDB site
Description: Human dUTP Pyrophosphatase complex with dUDP
Deposited on 2003-08-07, released 2003-08-19
The last revision prior to the SCOP 1.71 freeze date was dated 2003-08-19, with a file datestamp of 2003-08-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1q5ha_
  • Chain 'B':
    Domains in SCOP 1.71: d1q5hb_
  • Chain 'C':
    Domains in SCOP 1.71: d1q5hc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5hA (A:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5hA (A:)
    mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
    prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
    evqaldd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q5hB (B:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5hB (B:)
    mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
    prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
    evqalddtergsggfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q5hC (C:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5hC (C:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfg