PDB entry 1q5h

View 1q5h on RCSB PDB site
Description: Human dUTP Pyrophosphatase complex with dUDP
Class: hydrolase
Keywords: DNA repair, enzyme-DNA interactions, HYDROLASE
Deposited on 2003-08-07, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dUTP pyrophosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q5ha_
  • Chain 'B':
    Compound: dUTP pyrophosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q5hb_
  • Chain 'C':
    Compound: dUTP pyrophosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33316 (6-End)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d1q5hc1, d1q5hc2
  • Heterogens: MG, DUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5hA (A:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5hA (A:)
    mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
    prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
    evqaldd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q5hB (B:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5hB (B:)
    mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
    prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
    evqalddtergsggfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q5hC (C:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfgstgkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5hC (C:)
    hhhhhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsg
    cygrvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqliceri
    fypeieevqalddtergsggfg