PDB entry 1q5f

View 1q5f on RCSB PDB site
Description: nmr structure of type ivb pilin (pils) from salmonella typhi
Deposited on 2003-08-07, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1q5fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q5fA (A:)
    mwgkkdagteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpas
    gsatlwnswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikin
    gnnhtdakvtaeiassectadngrtgtntlvfnyng