PDB entry 1q5f

View 1q5f on RCSB PDB site
Description: NMR Structure of Type IVb pilin (PilS) from Salmonella typhi
Class: cell adhesion
Keywords: TYPE IVb PILIN, ALPHA-BETA ROLL, MONOMER, CELL ADHESION
Deposited on 2003-08-07, released 2004-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PilS
    Species: SALMONELLA TYPHI [TaxId:601]
    Gene: PilS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q5fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q5fA (A:)
    mwgkkdagteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpas
    gsatlwnswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikin
    gnnhtdakvtaeiassectadngrtgtntlvfnyng