PDB entry 1q5d

View 1q5d on RCSB PDB site
Description: Epothilone B-bound Cytochrome P450epoK
Class: oxidoreductase
Keywords: cytochrome P450, epothilone, oxydoreductase, heme-enzyme, OXIDOREDUCTASE
Deposited on 2003-08-06, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.22
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: P450 epoxidase
    Species: Sorangium cellulosum [TaxId:56]
    Gene: epoK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q5da_
  • Heterogens: HEM, EPB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q5dA (A:)
    mtqeqanqsetkpafdfkpfapgyaedpfpaierlreatpifywdegrswvltryhdvsa
    vfrderfavsreewessaeyssaipelsdmkkyglfglppedharvrklvnpsftsraid
    llraeiqrtvdqlldarsgqeefdvvrdyaegipmraisallkvpaecdekfrrfgsata
    ralgvglvprvdeetktlvasvteglallhgvlderrrnplendvltmllqaeadgsrls
    tkelvalvgaiiaagtdttiyliafavlnllrspealelvkaepglmrnaldevlrfdni
    lrigtvrfarqdleycgasikkgemvfllipsalrdgtvfsrpdvfdvrrdtsaslaygr
    gphvcpgvslarleaeiavgtifrrfpemklketpvfgyhpafrnieslnvilkpskag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q5dA (A:)
    dfkpfapgyaedpfpaierlreatpifywdegrswvltryhdvsavfrderfavsreewe
    ssaeyssaipelsdmkkyglfglppedharvrklvnpsftsraidllraeiqrtvdqlld
    arsgqeefdvvrdyaegipmraisallkvpaecdekfrrfgsataralgvglvprvdeet
    ktlvasvteglallhgvlderrrnplendvltmllqaeadgsrlstkelvalvgaiiaag
    tdttiyliafavlnllrspealelvkaepglmrnaldevlrfdnilrigtvrfarqdley
    cgasikkgemvfllipsalrdgtvfsrpdvfdvrrdtsaslaygrgphvcpgvslarlea
    eiavgtifrrfpemklketpvfgyhpafrnieslnvilkps