PDB entry 1q59

View 1q59 on RCSB PDB site
Description: Solution Structure of the BHRF1 Protein From Epstein-Barr Virus, a Homolog of Human Bcl-2
Class: Viral protein
Keywords: BHRF1, Bcl-2, Epstein-Barr Virus, NMR spectroscopy, Structure determination, Viral protein
Deposited on 2003-08-06, released 2003-09-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Early antigen protein R
    Species: Human herpesvirus 4 [TaxId:10376]
    Gene: BHRF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03182 (0-159)
      • cloning artifact (160-171)
    Domains in SCOPe 2.03: d1q59a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q59A (A:)
    maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlleeiier
    nsetftetwnrfithtehvdldfnsvfleifhrgdpslgralawmawcmhacrtlccnqs
    tpyyvvdlsvrgmleasegldgwihqqggwstliednipgddddlehhhhhh