PDB entry 1q59

View 1q59 on RCSB PDB site
Description: solution structure of the bhrf1 protein from epstein-barr virus, a homolog of human bcl-2
Deposited on 2003-08-06, released 2003-09-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q59a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1q59A (A:)
maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlleeiier
nsetftetwnrfithtehvdldfnsvfleifhrgdpslgralawmawcmhacrtlccnqs
tpyyvvdlsvrgmleasegldgwihqqggwstliednipgddddlehhhhhh