PDB entry 1q53

View 1q53 on RCSB PDB site
Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081
Deposited on 2003-08-06, released 2003-08-19
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q53a_
  • Chain 'B':
    Domains in SCOP 1.67: d1q53b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q53A (A:)
    gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
    qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q53B (B:)
    gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
    qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl