PDB entry 1q53

View 1q53 on RCSB PDB site
Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, Protein Structure Initiative, CESG, PSI, Center for Eukaryotic Structural Genomics
Deposited on 2003-08-06, released 2003-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: expressed protein: At3g17210
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LUV2 (3-111)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1q53a1, d1q53a2
  • Chain 'B':
    Compound: expressed protein: At3g17210
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LUV2 (3-111)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1q53b1, d1q53b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q53A (A:)
    gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
    qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q53B (B:)
    gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
    qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl