PDB entry 1q52

View 1q52 on RCSB PDB site
Description: Crystal Structure of Mycobacterium tuberculosis MenB, a Key Enzyme in Vitamin K2 Biosynthesis
Class: lyase
Keywords: LYASE, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2003-08-05, released 2004-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52a_
  • Chain 'B':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52b_
  • Chain 'C':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52c_
  • Chain 'D':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52d_
  • Chain 'E':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52e_
  • Chain 'F':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52f_
  • Chain 'G':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52g_
  • Chain 'H':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52h_
  • Chain 'I':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52i_
  • Chain 'J':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52j_
  • Chain 'K':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52k_
  • Chain 'L':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q52l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q52A (A:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52A (A:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q52B (B:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52B (B:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdtvdvaragrlhilevqrlirfmpkvviclvn
    gwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareiffl
    grtytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgq
    qlfageatrlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q52C (C:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52C (C:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q52D (D:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52D (D:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1q52E (E:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52E (E:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1q52F (F:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52F (F:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1q52G (G:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52G (G:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q52H (H:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52H (H:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1q52I (I:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52I (I:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1q52J (J:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52J (J:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1q52K (K:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52K (K:)
    sdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldh
    armspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1q52L (L:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q52L (L:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdhilevqrlirfmpkvviclvngwaaggghsl
    hvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmh
    qmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrl
    aymtdeavegrdaflqkrppdwspfpryf