PDB entry 1q51

View 1q51 on RCSB PDB site
Description: Crystal Structure of Mycobacterium tuberculosis MenB in Complex with Acetoacetyl-Coenzyme A, a Key Enzyme in Vitamin K2 Biosynthesis
Class: lyase
Keywords: LYASE, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2003-08-05, released 2004-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51a_
  • Chain 'B':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51b_
  • Chain 'C':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51c_
  • Chain 'D':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51d_
  • Chain 'E':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51e_
  • Chain 'F':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51f_
  • Chain 'G':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51g_
  • Chain 'H':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51h_
  • Chain 'I':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51i_
  • Chain 'J':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51j_
  • Chain 'K':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51k_
  • Chain 'L':
    Compound: menB
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: menB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1q51l_
  • Heterogens: CAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q51A (A:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51A (A:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q51B (B:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51B (B:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqtvdvaragrlhilevqrlirfmpkvviclv
    ngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareiff
    lgrtytaeqmhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvg
    qqlfageatrlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q51C (C:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51C (C:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q51D (D:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51D (D:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1q51E (E:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51E (E:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1q51F (F:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51F (F:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1q51G (G:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51G (G:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q51H (H:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51H (H:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1q51I (I:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51I (I:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1q51J (J:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51J (J:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1q51K (K:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51K (K:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1q51L (L:)
    mvapageqgrsstalsdnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrna
    frphtvdelyrvldharmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasg
    dtadtvdvaragrlhilevqrlirfmpkvviclvngwaaggghslhvvcdltlasreyar
    fkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeqmhqmgavnavaehaele
    tvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdafl
    qkrppdwspfpryf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q51L (L:)
    npfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldhar
    mspdvgvvlltgngpspkdggwafcsggdqlhilevqrlirfmpkvviclvngwaagggh
    slhvvcdltlasreyarfkqtdadvgsfdggygsaylarqvgqkfareifflgrtytaeq
    mhqmgavnavaehaeletvglqwaaeinakspqaqrmlkfafnllddglvgqqlfageat
    rlaymtdeavegrdaflqkrppdwspfpryf