PDB entry 1q50

View 1q50 on RCSB PDB site
Description: Phosphoglucose isomerase from Leishmania mexicana.
Class: isomerase
Keywords: isomerase
Deposited on 2003-08-05, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q50a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q50A (A:)
    gvtdssllnlpawkrlqslyekygndsilshfekdhqrfqrysieidlhsddnflfldys
    kshindeikdalvalaeergvrafakamfdgqrvnstenravlhvalrnrsnrpiivdgk
    dvmsdvnnvlaqmkdftervrsgewkgqtgksiynivnigiggsdlgpvmvtealkpfsk
    rdlhcffvsnvdgthmaevlkqvnleetifiiasktfttqetltnamsarnalmsylken
    gistdgavakhfvalstntekvrefgidtvnmfafwdwvggrysvwsaiglsvmlsigyd
    nfvefltgahvmdnhfastpteqnlpmmlalvgiwynnffgsetqavlpydqylwrlpay
    lqqldmesngkgvtkksgavavqtgpivfgeagtngqhafyqlihqgtkiipcdfigcvq
    tqnrvgdhhrtlmsnffaqtealmvgknaeevrqelvksgmsgdaienmiphktftgsrp
    snsilvnaltpralgaiiamyehkvlvqgaiwginsydqwgvelgkvlaksilpqlksgn
    ivsdhdgstnglinmfntrah