PDB entry 1q4r

View 1q4r on RCSB PDB site
Description: Gene Product of At3g17210 from Arabidopsis Thaliana
Class: unknown function, structural genomics
Keywords: Arabidopsis Thaliana, Center for Eukaryotic Structural Genomics, Structural Genomics, Protein Structure Initiative, CESG, UNKNOWN FUNCTION
Deposited on 2003-08-04, released 2003-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein At3g17210
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: At3g17210
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LUV2 (Start-111)
    • modified residue (44)
  Domains in SCOPe 2.05: d1q4ra_
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1q4rA (A:)
  gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
  qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1q4rA (A:)
  pvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgythifes
  tfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl