PDB entry 1q4m

View 1q4m on RCSB PDB site
Description: Gene Product of At3g16990 from Arabidopsis Thaliana
Class: plant protein
Keywords: Arabidopsis Thaliana, Center for Eukaryotic Structural Genomics, Structural Genomics, Protein Structure Initiative, CESG
Deposited on 2003-08-04, released 2003-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2005-12-13, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.224
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed maturation protein -related
    Species: Arabidopsis thaliana
    Gene: At3g16990
    Database cross-references and differences (RAF-indexed):
    • GB NP_188324
      • modified residue (74)
      • modified residue (122)
      • modified residue (132)
      • modified residue (215)
    Domains in SCOPe 2.06: d1q4ma_
  • Chain 'B':
    Compound: seed maturation protein -related
    Species: Arabidopsis thaliana
    Gene: At3g16990
    Database cross-references and differences (RAF-indexed):
    • GB NP_188324
      • modified residue (74)
      • modified residue (122)
      • modified residue (132)
      • modified residue (215)
    Domains in SCOPe 2.06: d1q4mb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q4mA (A:)
    mekrgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvas
    vlirackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfle
    dlmssevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssv
    kniaerclenasgevlgeaedvlvrvlelevafwemsrggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q4mA (A:)
    gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
    ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
    sevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvknia
    erclenasgevlgeaedvlvrvlelevafwemsrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q4mB (B:)
    mekrgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvas
    vlirackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfle
    dlmssevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssv
    kniaerclenasgevlgeaedvlvrvlelevafwemsrggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q4mB (B:)
    rgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvli
    rackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlm
    ssevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvkni
    aerclenasgevlgeaedvlvrvlelevafwemsrg