PDB entry 1q4g

View 1q4g on RCSB PDB site
Description: 2.0 Angstrom Crystal Structure of Ovine Prostaglandin H2 Synthase-1, in complex with alpha-methyl-4-biphenylacetic acid
Class: oxidoreductase
Keywords: cyclooxygenase, non-steroidal anti-inflammatory drug, peroxidase, prostaglandin synthase, EGF-like domain, membrane binding domain, OXIDOREDUCTASE
Deposited on 2003-08-03, released 2004-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin G/H synthase 1
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • GB AAA31511 (0-552)
    Domains in SCOPe 2.07: d1q4ga1, d1q4ga2
  • Chain 'B':
    Compound: Prostaglandin G/H synthase 1
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
    • GB AAA31511 (0-552)
    Domains in SCOPe 2.07: d1q4gb1, d1q4gb2
  • Heterogens: BOG, BFL, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q4gA (A:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q4gB (B:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvpd