PDB entry 1q48

View 1q48 on RCSB PDB site
Description: Solution NMR Structure of The Haemophilus Influenzae Iron-Sulfur Cluster Assembly Protein U (IscU) with Zinc Bound at the Active Site. Northeast Structural Genomics Consortium Target IR24. This protein is not apo, it is a model without zinc binding constraints.
Class: structural genomics, unknown function
Keywords: Iron-Sulfur cluster binding, Three conserved Cys, 3 beta strands, 4 alpha helixes, NESG, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2003-08-01, released 2003-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NifU-like protein
  Species: Haemophilus influenzae [TaxId:727]
  Gene: HI0377
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57074 (0-125)
    • insertion (126-133)
  Domains in SCOPe 2.06: d1q48a1, d1q48a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q48A (A:)
  maysekvidhyenprnvgsldkkdsnvgtgmvgapacgdvmqlqikvddngiiedakfkt
  ygcgsaiassslitewvkgksleeagaiknsqiaeelelppvkvhcsilaedaikaaiad
  ykakqglehhhhhh