PDB entry 1q47

View 1q47 on RCSB PDB site
Description: Structure of the Semaphorin 3A Receptor-Binding Module
Class: signaling protein
Keywords: beta propeller, SIGNALING PROTEIN
Deposited on 2003-08-01, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Semaphorin 3A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q47a_
  • Chain 'B':
    Compound: Semaphorin 3A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q47b_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q47A (A:)
    knnvprlklsykemlesnnvitfnglansssyhtflldeersrlyvgakdhifsfnlvni
    kdfqkivwpvsytrrdeckwagkdilkecanfikvleaynqthlyacgtgafhpictyie
    vghhpednifklqdshfengrgkspydpklltasllidgelysgtaadfmgrdfaifrtl
    ghhhpirteqhdsrwlndprfisahlipesdnpeddkvyfffrenaidgehsgkathari
    gqickndfgghrslvnkwttflkarlicsvpgpngidthfdelqdvflmnskdpknpivy
    gvfttssnifkgsavcmysmsdvrrvflgpyahrdgpnyqwvpyqgrvpyprpgtcpskt
    fggfdstkdlpddvitfarshpamynpvfpinnrpimiktdvnyqftqivvdrvdaedgq
    ydvmfigtdvgtvlkvvsvpketwhdleevlleemtvfrepttisamelstkqqqlyigs
    tagvaqlplhrcdiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q47A (A:)
    knnvprlklsykemlesnnvitfnglansssyhtflldeersrlyvgakdhifsfnlvni
    kdfqkivwpvsytrrdeckwagkdilkecanfikvleaynqthlyacgtgafhpictyie
    vghhpednifklqdshfengrgkspydpklltasllidgelysgtaadfmgrdfaifrtl
    ghhhpirteqhdsrwlndprfisahlipesdnpeddkvyfffrenaidgehsgkathari
    gqickndfgghrslvnkwttflkarlicsvpgpngidthfdelqdvflmnskdpknpivy
    gvfttssnifkgsavcmysmsdvrrvflgpyahrdgpnyqwvpyqgrvpyprpgtcpskt
    fggfdstkdlpddvitfarshpamynpvfpinnrpimiktdvnyqftqivvdrvdaedgq
    ydvmfigtdvgtvlkvvsvlleemtvfrepttisamelstkqqqlyigstagvaqlplhr
    cdiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q47B (B:)
    knnvprlklsykemlesnnvitfnglansssyhtflldeersrlyvgakdhifsfnlvni
    kdfqkivwpvsytrrdeckwagkdilkecanfikvleaynqthlyacgtgafhpictyie
    vghhpednifklqdshfengrgkspydpklltasllidgelysgtaadfmgrdfaifrtl
    ghhhpirteqhdsrwlndprfisahlipesdnpeddkvyfffrenaidgehsgkathari
    gqickndfgghrslvnkwttflkarlicsvpgpngidthfdelqdvflmnskdpknpivy
    gvfttssnifkgsavcmysmsdvrrvflgpyahrdgpnyqwvpyqgrvpyprpgtcpskt
    fggfdstkdlpddvitfarshpamynpvfpinnrpimiktdvnyqftqivvdrvdaedgq
    ydvmfigtdvgtvlkvvsvpketwhdleevlleemtvfrepttisamelstkqqqlyigs
    tagvaqlplhrcdiy