PDB entry 1q46

View 1q46 on RCSB PDB site
Description: crystal structure of the eIF2 alpha subunit from saccharomyces cerevisia
Class: translation
Keywords: initiation factor, eIF2, translation, phosphorylation site
Deposited on 2003-08-01, released 2003-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.218
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 alpha subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1q46a1, d1q46a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q46A (A:)
    stshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqk
    lirvgkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaekfqi
    pleelyktiawplsrkfghayeafklsiidetvwegieppskdvldelknyiskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q46A (A:)
    tshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqkl
    irvgkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaekfqip
    leelyktiawplsrkfghayeafklsiidetvwegieppskdvldelknyiskr