PDB entry 1q46

View 1q46 on RCSB PDB site
Description: crystal structure of the eIF2 alpha subunit from saccharomyces cerevisia
Deposited on 2003-08-01, released 2003-10-28
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.218
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q46a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q46A (A:)
    stshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqk
    lirvgkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaekfqi
    pleelyktiawplsrkfghayeafklsiidetvwegieppskdvldelknyiskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q46A (A:)
    tshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqkl
    irvgkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaekfqip
    leelyktiawplsrkfghayeafklsiidetvwegieppskdvldelknyiskr