PDB entry 1q44

View 1q44 on RCSB PDB site
Description: Crystal Structure of an Arabidopsis Thaliana Putative Steroid Sulfotransferase
Class: transferase
Keywords: Arabidopsis Thaliana, Steroid Sulfotransferase, Apo, Structural Genomics, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, transferase
Deposited on 2003-08-01, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroid Sulfotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g03760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q44a_
  • Heterogens: MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q44A (A:)
    msssssvpaylgdedltqetralisslpkekgwlvseiyefqglwhtqailqgilicqkr
    feakdsdiilvtnpksgttwlkalvfallnrhkfpvsssgnhpllvtnphllvpflegvy
    yespdfdfsslpsprlmnthishlslpesvksssckivyccrnpkdmfvslwhfgkklap
    eetadypiekaveafcegkfiggpfwdhileywyasrenpnkvlfvtyeelkkqtevemk
    riaeflecgfieeeevreivklcsfeslsnlevnkegklpngietktffrkgeiggwrdt
    lseslaeeidrtieekfkgsglkfss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q44A (A:)
    svpaylgdedltqetralisslpkekgwlvseiyefqglwhtqailqgilicqkrfeakd
    sdiilvtnpksgttwlkalvfallnrhkfpvsssgnhpllvtnphllvpflegvyyespd
    fdfsslpsprlmnthishlslpesvksssckivyccrnpkdmfvslwhfgkklypiekav
    eafcegkfiggpfwdhileywyasrenpnkvlfvtyeelkkqtevemkriaeflecgfie
    eeevreivklcsfegwrdtlseslaeeidrtieekfkgsglkfs