PDB entry 1q42

View 1q42 on RCSB PDB site
Description: Crystal structure analysis of the Candida albicans Mtr2
Deposited on 2003-08-01, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.225
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1q42a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q42A (A:)
    mgsshhhhhhssglvprgshmnqdptqqlepflkrflasldllytqptsqpfpnvesyat
    qlgsnlkrssaiivngqpiipspqedcklqfqkkwlqtplsshqltsydghlipgtgtfv
    vhfsakvrfdqsgrnrlgesadlfqennsivsktnqrpiwgswfgvdvnlvvdenvmqdg
    eiinsmdyrftyvpndsiikv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q42A (A:)
    qdptqqlepflkrflasldllytqptsqpfpnvesyatqlgsnlkrssaiivngqpiips
    pqedcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesar
    piwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd