PDB entry 1q42

View 1q42 on RCSB PDB site
Description: Crystal structure analysis of the Candida albicans Mtr2
Class: translation
Keywords: Mtr2; NTF2-fold; nuclear export, TRANSLATION
Deposited on 2003-08-01, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.225
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA transport regulator mtr2
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q42a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q42A (A:)
    mgsshhhhhhssglvprgshmnqdptqqlepflkrflasldllytqptsqpfpnvesyat
    qlgsnlkrssaiivngqpiipspqedcklqfqkkwlqtplsshqltsydghlipgtgtfv
    vhfsakvrfdqsgrnrlgesadlfqennsivsktnqrpiwgswfgvdvnlvvdenvmqdg
    eiinsmdyrftyvpndsiikv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q42A (A:)
    qdptqqlepflkrflasldllytqptsqpfpnvesyatqlgsnlkrssaiivngqpiips
    pqedcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesar
    piwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd