PDB entry 1q40

View 1q40 on RCSB PDB site
Description: Crystal structure of the C. albicans Mtr2-Mex67 M domain complex
Class: translation
Keywords: NTF2-fold; nuclear export, TRANSLATION
Deposited on 2003-08-01, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.178
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA transport regulator mtr2
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q40a_
  • Chain 'B':
    Compound: mRNA export factor mex67
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q40b_
  • Chain 'C':
    Compound: mRNA transport regulator mtr2
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q40c_
  • Chain 'D':
    Compound: mRNA export factor mex67
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q40d_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q40A (A:)
    mgsshhhhhhssglvprgshmnqdptqqlepflkrflasldllytqptsqpfpnvesyat
    qlgsnlkrssaiivngqpiipspqedcklqfqkkwlqtplsshqltsydghlipgtgtfv
    vhfsakvrfdqsgrnrlgesadlfqennsivsktnqrpiwgswfgvdvnlvvdenvmqdg
    eiinsmdyrftyvpndsiikv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q40A (A:)
    qdptqqlepflkrflasldllytqsqpfpnvesyatqlgsnlkrssaiivngqpiipspq
    edcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesadlf
    qennqrpiwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q40B (B:)
    mspetmffqdedsrnlatnfianylklwdanrselmilyqnesqfsmqvdsshphliesg
    nsgysgstdfgyylnnsrnltrvssikarmaklsigqeqiyksfqqlpktrhdiiatpel
    fsmevykfptlngimitlhgsfdevaqpevdgsassapsgprggsryhsgpkhkriplsk
    ksfdrtfvvipgpngsmivasdtllirpytsdfpwkvqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q40B (B:)
    srnlatnfianylklwdanrselmilyqnesqfsmqvdsshphliesgstdfgyylnnsr
    nltrvssikarmaklsigqeqiyksfqqlpktrhdiiatpelfsmevykfptlngimitl
    hgsfdevaqpevdgsasryhsgpkhkriplskksfdrtfvvipgsmivasdtllirpyts
    dfpwkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q40C (C:)
    mgsshhhhhhssglvprgshmnqdptqqlepflkrflasldllytqptsqpfpnvesyat
    qlgsnlkrssaiivngqpiipspqedcklqfqkkwlqtplsshqltsydghlipgtgtfv
    vhfsakvrfdqsgrnrlgesadlfqennsivsktnqrpiwgswfgvdvnlvvdenvmqdg
    eiinsmdyrftyvpndsiikv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q40C (C:)
    qdptqqlepflkrflasldllytqptsqpfpnvesyatqlgsnlkrssaiivngqpiips
    pqedcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesad
    lfqqrpiwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q40D (D:)
    mspetmffqdedsrnlatnfianylklwdanrselmilyqnesqfsmqvdsshphliesg
    nsgysgstdfgyylnnsrnltrvssikarmaklsigqeqiyksfqqlpktrhdiiatpel
    fsmevykfptlngimitlhgsfdevaqpevdgsassapsgprggsryhsgpkhkriplsk
    ksfdrtfvvipgpngsmivasdtllirpytsdfpwkvqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q40D (D:)
    dsrnlatnfianylklwdanrselmilyqnesqfsmqvdsshphlsgstdfgyylnnsrn
    ltrvssikarmaklsigqeqiyksfqqlpktrhdiiatpelfsmevykfptlngimitlh
    gsfdevaqpevdgskriplskksfdrtfvvipgpsmivasdtllirpytsdfpwk