PDB entry 1q3z

View 1q3z on RCSB PDB site
Description: NMR structure of the Cys28His mutant (E form) of the nucleocapsid protein NCp7 of HIV-1.
Class: Viral protein
Keywords: CCHC zinc knuckle, CCHH zinc knuckle, Viral protein
Deposited on 2003-08-01, released 2004-09-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PY17 (Start-41)
      • see remark 999 (1)
      • engineered (16)
    Domains in SCOPe 2.01: d1q3za_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q3zA (A:)
    nvkcfncgkeghtarnhraprkkgcwkcgkeghqmkdcterq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3zA (A:)
    vkcfncgkeghtarnhraprkkgcwkcgkeghqmkdcterq