PDB entry 1q3t

View 1q3t on RCSB PDB site
Description: Solution structure and function of an essential CMP kinase of Streptococcus pneumoniae
Class: transferase
Keywords: nucleotide monophosphate kinase, CMP kinase, cytidylate kinase
Deposited on 2003-07-31, released 2004-08-03
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-03, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidylate kinase
    Species: Streptococcus pneumoniae
    Gene: CMP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1q3ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q3tA (A:)
    mkhhhhhhddddkmktiqiaidgpassgkstvakiiakdfgftyldtgamyraatymalk
    nqlgveeveallalldqhpisfgrsetgdqlvfvgdvdithpirenevtnhvsaiaaipe
    vreklvslqqeiaqqggivmdgrdigtvvlpqaelkiflvasvderaerrykeniakgie
    tdletlkkeiaardykdshretsplkqaedavyldttglniqevvekikaeaekrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3tA (A:)
    mktiqiaidgpassgkstvakiiakdfgftyldtgamyraatymalknqlgveevealla
    lldqhpisfgrsetgdqlvfvgdvdithpirenevtnhvsaiaaipevreklvslqqeia
    qqggivmdgrdigtvvlpqaelkiflvasvderaerrykeniakgietdletlkkeiaar
    dykdshretsplkqaedavyldttglniqevvekikaeaekrm