PDB entry 1q3s

View 1q3s on RCSB PDB site
Description: Crystal structure of the chaperonin from Thermococcus strain KS-1 (FormIII crystal complexed with ADP)
Class: chaperone
Keywords: chaperone, chaperonin, thermosome
Deposited on 2003-07-31, released 2004-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.251
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
    Domains in SCOPe 2.06: d1q3sa1, d1q3sa2, d1q3sa3
  • Chain 'B':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
    Domains in SCOPe 2.06: d1q3sb1, d1q3sb2, d1q3sb3
  • Chain 'C':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
    Domains in SCOPe 2.06: d1q3sc1, d1q3sc2, d1q3sc3
  • Chain 'D':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
    Domains in SCOPe 2.06: d1q3sd1, d1q3sd2, d1q3sd3
  • Chain 'E':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
    Domains in SCOPe 2.06: d1q3se1, d1q3se2, d1q3se3
  • Chain 'F':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
    Domains in SCOPe 2.06: d1q3sf1, d1q3sf2, d1q3sf3
  • Chain 'G':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
    Domains in SCOPe 2.06: d1q3sg1, d1q3sg2, d1q3sg3
  • Chain 'H':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
    Domains in SCOPe 2.06: d1q3sh1, d1q3sh2, d1q3sh3
  • Heterogens: MG, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q3sA (A:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiiikgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3sA (A:)
    vilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcatil
    dkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiiikgya
    laaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaekk
    dgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealevk
    ktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylakyg
    imavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegcknp
    kavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakqv
    ggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpadm
    lekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q3sB (B:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiiikgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3sB (B:)
    vilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcatil
    dkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiiikgya
    laaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaekk
    dgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealevk
    ktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylakyg
    imavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegcknp
    kavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakqv
    ggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpadm
    lekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q3sC (C:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiiikgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3sC (C:)
    vilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcatil
    dkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiiikgya
    laaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaekk
    dgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealevk
    ktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylakyg
    imavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegcknp
    kavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakqv
    ggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpadm
    lekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q3sD (D:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiiikgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3sD (D:)
    vilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcatil
    dkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiiikgya
    laaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaekk
    dgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealevk
    ktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylakyg
    imavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegcknp
    kavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakqv
    ggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpadm
    lekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1q3sE (E:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiiikgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3sE (E:)
    vilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcatil
    dkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiiikgya
    laaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaekk
    dgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealevk
    ktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylakyg
    imavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegcknp
    kavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakqv
    ggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpadm
    lekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1q3sF (F:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiiikgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3sF (F:)
    vilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcatil
    dkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiiikgya
    laaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaekk
    dgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealevk
    ktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylakyg
    imavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegcknp
    kavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakqv
    ggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpadm
    lekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1q3sG (G:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiiikgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3sG (G:)
    vilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcatil
    dkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiiikgya
    laaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaekk
    dgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealevk
    ktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylakyg
    imavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegcknp
    kavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakqv
    ggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpadm
    lekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q3sH (H:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiiikgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3sH (H:)
    vilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcatil
    dkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiiikgya
    laaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaekk
    dgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealevk
    ktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylakyg
    imavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegcknp
    kavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakqv
    ggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpadm
    lekgiieplrvkkqaiksaseaaimilriddviaaka