PDB entry 1q3r

View 1q3r on RCSB PDB site
Description: Crystal structure of the chaperonin from Thermococcus strain KS-1 (nucleotide-free form of single mutant)
Class: chaperone
Keywords: chaperone, chaperonin, thermosome
Deposited on 2003-07-31, released 2004-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (124)
    Domains in SCOPe 2.06: d1q3ra1, d1q3ra2, d1q3ra3
  • Chain 'B':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (124)
    Domains in SCOPe 2.06: d1q3rb1, d1q3rb2, d1q3rb3
  • Chain 'C':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (124)
    Domains in SCOPe 2.06: d1q3rc1, d1q3rc2, d1q3rc3
  • Chain 'D':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (124)
    Domains in SCOPe 2.06: d1q3rd1, d1q3rd2, d1q3rd3
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q3rA (A:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndgatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3rA (A:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndgati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q3rB (B:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndgatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3rB (B:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndgati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q3rC (C:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndgatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3rC (C:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndgati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q3rD (D:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndgatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3rD (D:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndgati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka