PDB entry 1q3q

View 1q3q on RCSB PDB site
Description: Crystal structure of the chaperonin from Thermococcus strain KS-1 (two-point mutant complexed with AMP-PNP)
Class: chaperone
Keywords: chaperone, chaperonin, thermosome
Deposited on 2003-07-31, released 2004-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
      • engineered (124)
    Domains in SCOPe 2.07: d1q3qa1, d1q3qa2, d1q3qa3
  • Chain 'B':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
      • engineered (124)
    Domains in SCOPe 2.07: d1q3qb1, d1q3qb2, d1q3qb3
  • Chain 'C':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
      • engineered (124)
    Domains in SCOPe 2.07: d1q3qc1, d1q3qc2, d1q3qc3
  • Chain 'D':
    Compound: Thermosome alpha subunit
    Species: Thermococcus sp. [TaxId:79679]
    Gene: THSA OR CPKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24729
      • engineered (64)
      • engineered (124)
    Domains in SCOPe 2.07: d1q3qd1, d1q3qd2, d1q3qd3
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q3qA (A:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3qA (A:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q3qB (B:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3qB (B:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q3qC (C:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3qC (C:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q3qD (D:)
    maqlsgqpvvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdiv
    vtndcatildkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnih
    psiitkgyalaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklave
    avkqvaekkdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakia
    linealevkktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddl
    aqhylakygimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenm
    ifvegcknpkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielai
    rldeyakqvggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigid
    vfegkpadmlekgiieplrvkkqaiksaseaaimilriddviaakatkpeggqgggmpgg
    mggmdmgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q3qD (D:)
    vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
    ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
    alaaekaqeildeiairvdpddeetllkiaatsitgknaeshkellaklaveavkqvaek
    kdgkyvvdldnikfekkagegveeselvrgvvidkevvhprmpkrvenakialinealev
    kktetdakinitspdqlmsfleqeekmlkdmvdhiaqtganvvfvqkgiddlaqhylaky
    gimavrrvkksdmeklakatgakivtnvkdltpedlgyaevveerklagenmifvegckn
    pkavtilirggtehvideveraledavkvvkdvmedgavlpaggapeielairldeyakq
    vggkealaienfadalkiipktlaenagldtvemlvkvisehknrglgigidvfegkpad
    mlekgiieplrvkkqaiksaseaaimilriddviaaka