PDB entry 1q3p

View 1q3p on RCSB PDB site
Description: Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization
Class: peptide binding protein
Keywords: shank, PDZ, GKAP, crystal structure, PEPTIDE BINDING PROTEIN
Deposited on 2003-07-31, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.251
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shank1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: shank1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q3pa_
  • Chain 'B':
    Compound: Shank1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: shank1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q3pb_
  • Chain 'C':
    Compound: C-terminal hexapeptide from Guanylate kinase-associated protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_075235 (0-5)
  • Chain 'D':
    Compound: C-terminal hexapeptide from Guanylate kinase-associated protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_075235 (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1q3pA (A:)
gsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawr
aglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

    Sequence, based on observed residues (ATOM records): (download) 
    >1q3pA (A:)
dyiikektvllqkkdsegfgfvlrgaieeftptpafpalqylesvdeggvawraglrmgd
flievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1q3pB (B:)
gsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawr
aglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

    Sequence, based on observed residues (ATOM records): (download) 
    >1q3pB (B:)
gsdyiikektvllqkkdsegfgfvlrgaieeftptpafpalqylesvdeggvawraglrm
gdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpd

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.