PDB entry 1q3m

View 1q3m on RCSB PDB site
Description: 1H NMR structure bundle of bovine Ca2+-osteocalcin
Class: Calcium-binding protein
Keywords: Bone Protein, calcium binding protein, Calcium-binding protein
Deposited on 2003-07-30, released 2003-09-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Osteocalcin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02820 (Start-48)
    • modified residue (16)
    • modified residue (20)
    • modified residue (23)
  Domains in SCOPe 2.03: d1q3ma_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1q3mA (A:)
  yldhwlgapapypdplepkrevcelnpdcdeladhigfqeayrrfygpv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1q3mA (A:)
  lepkrevcelnpdcdeladhigfqeayrrfygpv